ArtNr |
CSB-EP020443DLU-10 |
Hersteller |
Cusabio
|
Menge |
10ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Research Topic |
Others |
Uniprot ID |
Q06559 |
Gene Names |
RpS3 |
Organism |
Drosophila melanogaster (Fruit fly) |
AA Sequence |
MNANLPISKKRKFVSDGIFKAELNEFLTRELAEDG YSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIRE LTAMVQKRFNFETGRIELYAEKVAARGLCAIAQAE SLRYKLTGGLAVRRACYGVLRYIMESGAKGCEVVV SGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATR HVLLRQGVLGIKVKVMLPYDPKNKIGPKKPLPDNV SVVEPKEEKIYETPETEYKIPPPSKPLDDLSEAKV |
Expression Region |
1-246aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
31.5 kDa |
Alternative Name(s) |
M(3)95A |
Relevance |
Has DNA repair activity directed towards the mutagenic lesions 8-oxoguanine and abasic sites in DNA. It can cleave DNA containing 8-oxoguanine residues efficiently. Also acts as an ap lyase, cleaving phosphodiester bonds via a beta, delta elimination reaction. |
Reference |
"A Drosophila ribosomal protein contains 8-oxoguanine and abasic site DNA repair activities." Yacoub A., Augeri L., Kelley M.R., Doetsch P.W., Deutsch W.A. EMBO J. 15:2306-2312(1996) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Has DNA repair activity directed towards the mutagenic lesions 8-oxoguanine and abasic sites in DNA. It can cleave DNA containing 8-oxoguanine residues efficiently. Also acts as an ap lyase, cleaving phosphodiester bonds via a beta, delta elimination reaction. |
Subcellular Location |
Cytoplasm, Nucleus |
Protein Families |
Universal ribosomal protein uS3 family |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.