ArtNr |
CSB-EP019630RA-200 |
Hersteller |
Cusabio
|
Menge |
200ug |
Quantity options |
1mg
10ug
100ug
20ug
200ug
50ug
500ug
|
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Gluconolactonase (EC:3.1.1.17),Short name:,GNL,Senescence marker protein 30,Short name:,SMP-30,Smp30 |
Lieferbar |
|
Research Topic |
Signal Transduction |
Uniprot ID |
Q03336 |
Gene Names |
Rgn |
Organism |
Rattus norvegicus (Rat) |
AA Sequence |
MSSIKIECVLRENYRCGESPVWEEASKCLLFVDIP SKTVCRWDSISNRVQRVGVDAPVSSVALRQSGGYV ATIGTKFCALNWEDQSVFILAMVDEDKKNNRFNDG KVDPAGRYFAGTMAEETAPAVLERHQGSLYSLFPD HSVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYTV DAFDYDLPTGQISNRRTVYKMEKDEQIPDGMCIDV EGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKT TSCCFGGKDYSEMYVTCARDGMSAEGLLRQPDAGN IFKITGLGVKGIAPYSYAG |
Expression Region |
1-299aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 10xHis-SUMO-tagged |
MW |
51.9 kDa |
Alternative Name(s) |
Gluconolactonase (EC:3.1.1.17) Short name: GNL Senescence marker protein 30 Short name: SMP-30 Smp30 |
Relevance |
Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Catalyzes a key step in ascorbic acid (vitamin C) biosynthesis. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca2+ signaling, and Ca2+-dependent cellular processes and enzyme activities. |
Reference |
"Senescence marker protein 30 functions as gluconolactonase in L-ascorbic acid biosynthesis, and its knockout mice are prone to scurvy." Kondo Y., Inai Y., Sato Y., Handa S., Kubo S., Shimokado K., Goto S., Nishikimi M., Maruyama N., Ishigami A. Proc. Natl. Acad. Sci. U.S.A. 103:5723-5728(2006) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Catalyzes a key step in ascorbic acid (vitamin C) biosynthesis. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca(2+) signaling, and Ca(2+)-dependent cellular processes and enzyme activities. |
Subcellular Location |
Cytoplasm |
Protein Families |
SMP-30/CGR1 family |
Tissue Specificity |
Detected in liver (at protein level). Hepatocytes and renal proximal tubular epithelium. |
Tag Information |
N-terminal 10xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.