ArtNr |
CSB-EP015961RA-200 |
Hersteller |
Cusabio
|
Menge |
200ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Kidney oxidase-1 |
Lieferbar |
|
Research Topic |
Cardiovascular |
Uniprot ID |
Q924V1 |
Gene Names |
Nox4 |
Organism |
Rattus norvegicus (Rat) |
AA Sequence |
GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVS EHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAH FPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISV INHPSDVMELRMIKENFKARPGQYIILHCPSVSAL ENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDL LLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEE SLNYE |
Expression Region |
210-424aa |
Sequence Info |
Extracellular Domain |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-B2M-tagged |
MW |
38.6 kDa |
Alternative Name(s) |
Kidney oxidase-1 |
Relevance |
Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB. |
Reference |
"Direct interaction of the novel Nox proteins with p22phox is required for the formation of a functionally active NADPH oxidase." Ambasta R.K., Kumar P., Griendling K.K., Schmidt H.H.H.W., Busse R., Brandes R.P. J. Biol. Chem. 279:45935-45941(2004) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB. |
Subcellular Location |
Endoplasmic reticulum membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein, Cell junction, focal adhesion |
Tissue Specificity |
Expressed in vascular smooth muscle. |
Tag Information |
N-terminal 6xHis-B2M-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.