ArtNr |
CSB-EP015222HUa0-200 |
Hersteller |
Cusabio
|
Menge |
200ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Research Topic |
Signal Transduction |
Uniprot ID |
Q02817 |
Gene Names |
MUC2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGS YKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYL TRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSR AGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGL QSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPE EEVAPASCSEHRAECERLLTAEAFADCQDL |
Expression Region |
36-240aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
28.8 kDa |
Alternative Name(s) |
Intestinal mucin-2 (MUC-2) (SMUC) |
Relevance |
Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer. |
Reference |
"Sulfotransferases of two specificities function in the reconstitution of high endothelial cell ligands for L-selectin." Bistrup A., Bhakta S., Lee J.K., Belov Y.Y., Gunn M.D., Zuo F.-R., Huang C.-C., Kannagi R., Rosen S.D., Hemmerich S. J. Cell Biol. 145:899-910(1999) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer. |
Subcellular Location |
Secreted |
Tissue Specificity |
Colon, small intestine, colonic tumors, bronchus, cervix and gall bladder. |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.