« Zurück
Home /
Recombinant Human Malonyl-CoA decarboxylase, mitochondrial(MLYCD)

Recombinant Human Malonyl-CoA decarboxylase, mitochondrial(MLYCD)

ArtNr	CSB-EP014646HU-1
Hersteller	Cusabio
Menge	1mg
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie	Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Human
Host	E.coli
Konjugat/Tag	Myc
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Areas	others
Target / Protein	O95822
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	O95822
AA Sequence	MDELLRRAVPPTPAYELREKTPAPAEGQCADFVSF YGGLAETAQRAELLGRLARGFGVDHGQVAEQSAGV LHLRQQQREAAVLLQAEDRLRYALVPRYRGLFHHI SKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMN GVLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISE AEAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEP LVVLHVALTGDISSNIQAIVKEHPPSETEEKNKIT AAIFYSISLTQQGLQGVELGTFLIKRVVKELQREF PHLGVFSSLSPIPGFTKWLLGLLNSQTKEHGRNEL FTDSECKEISEITGGPINETLKLLLSSSEWVQSEK LVRALQTPLMRLCAWYLYGEKHRGYALNPVANFHL QNGAVLWRINWMADVSLRGITGSCGLMANYRYFLE ETGPNSTSYLGSKIIKASEQVLSLVAQFQKNSKL
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region	40-493AA
Protein Length	Full Length of Mature Protein
MW	55.9 kDa
Relevance	Catalyzes the conversion of malonyl-CoA to acetyl-CoA. In the fatty acid biosynthesis MCD selectively removes malonyl-CoA and thus assures that methyl-malonyl-CoA is the only chain elongating substrate for fatty acid synthase and that fatty acids with multiple methyl side chains are produced. In peroxisomes it may be involved in degrading intraperoxisomal malonyl-CoA, which is generated by the peroxisomal beta-oxidation of odd chain-length dicarboxylic fatty acids. Plays a role in the metabolic balance between glucose and lipid oxidation in muscle independent of alterations in insulin signaling. May play a role in controlling the extent of ischemic injury by promoting glucose oxidation.
Reference	MCD encodes peroxisomal and cytoplasmic forms of malonyl-CoA decarboxylase and is mutated in malonyl-CoA decarboxylase deficiency. Sacksteder K.A., Morrell J.C., Wanders R.J.A., Matalon R., Gould S.J. J. Biol. Chem. 274:24461-24468(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the conversion of malonyl-CoA to acetyl-CoA. In the fatty acid biosynthesis MCD selectively removes malonyl-CoA and thus assures that methyl-malonyl-CoA is the only chain elongating substrate for fatty acid synthase and that fatty acids with multiple methyl side chains are produced. In peroxisomes it may be involved in degrading intraperoxisomal malonyl-CoA, which is generated by the peroxisomal beta-oxidation of odd chain-length dicarboxylic fatty acids. Plays a role in the metabolic balance between glucose and lipid oxidation in muscle independent of alterations in insulin signaling. May play a role in controlling the extent of ischemic injury by promoting glucose oxidation.
Involvement in disease	Malonyl-CoA decarboxylase deficiency (MLYCD deficiency)
Subcellular Location	Cytoplasm, Mitochondrion matrix, Peroxisome, Peroxisome matrix
Tissue Specificity	Expressed in fibroblasts and hepatoblastoma cells (at protein level). Expressed strongly in heart, liver, skeletal muscle, kidney and pancreas. Expressed in myotubes. Expressed weakly in brain, placenta, spleen, thymus, testis, ovary and small intestine.
Paythway	AMPKSignaling
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen