« Zurück
Home /
Recombinant Rat Mucosal addressin cell adhesion molecule 1(Madcam1),partial

Recombinant Rat Mucosal addressin cell adhesion molecule 1(Madcam1),partial

ArtNr	CSB-EP013308RA-10
Hersteller	Cusabio
Menge	10ug
Kategorie	Neuroscience Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Short name:,MAdCAM-1,Short name:,rMAdCAM-1
Lieferbar
Research Topic	Immunology
Uniprot ID	O70540
Gene Names	Madcam1
Organism	Rattus norvegicus (Rat)
AA Sequence	QSFQVNPPEPEVAVAMGTSLQINCSMSCDKDIARV HWHGLDTNLGNVQTLPGSRVLSVRGMLSDTGTRVC VGSCGSRSFQHSVKILVYAFPDQLEVTPEFLVPGR DQVVSCTAHNIWPAGPDSLSFALLRGEQSLEGAQA LETEQEEEMQETEGTPLFQVTQRWLLPSLGTPALP ALYCQVTMQLPKLVLTHRRKIPVLQSQTSPEPPST TSAKPYILTSSHTTKAVSTGLSSVALPSTPLSSEG PCYPEIHQNPEADWELLCEASCGSGVTVHWTLAPG DLAAYHKREAGAQAWLSVLPLGPIPEGWFQCRMDP GGQVTSLYVTGQVIPNPSS
Expression Region	20-353aa
Sequence Info	Extracellular Domain
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	52 kDa
Alternative Name(s)	Short name: MAdCAM-1 Short name: rMAdCAM-1
Relevance	Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both the integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes
Reference	"Cloning and characterization of the rat MAdCAM-1 cDNA and gene."Iizuka T., Koike R., Miyasaka N., Miyasaka M., Watanabe T.Biochim. Biophys. Acta 1395:266-270(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both the integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes (By similarity).
Subcellular Location	Membrane, Single-pass type I membrane protein
Tissue Specificity	Detected in Peyer patches and mesenteric lymph nodes but not in spleen.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP013308RA-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen