« Zurück
Home /
Recombinant Mouse Tyrosine-protein kinase JAK1(Jak1),partial

Recombinant Mouse Tyrosine-protein kinase JAK1(Jak1),partial

ArtNr	CSB-EP011930MO-1
Hersteller	Cusabio
Menge	1mg
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Colorectal Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Janus kinase 1,Short name:,JAK-1
Lieferbar
Research Areas	Others
Uniprot ID	P52332
Gene Names	Jak1
Organism	Mus musculus (Mouse)
AA Sequence	EEQNPDIVSEKQPTTEVDPTHFEKRFLKRIRDLGE GHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNH IADLKKEIEILRNLYHENIVKYKGICMEDGGNGIK LIMEFLPSGSLKEYLPKNKNKINLKQQLKYAIQIC KGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFG LTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKF YIASDVWSFGVTLHELLTYCDSDFSPMALFLKMIG PTHGQMTVTRLVKTLKEGKRLPCPPNCPDEVYQLM RKCWEFQPSNRTTFQNLIEGFEALL
Expression Region	848-1152aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	39.1 kDa
Alternative Name(s)	Janus kinase 1 Short name: JAK-1
Relevance	Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway. Kinase partner for the interleukin (IL)-2 receptor. ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
Reference	Molecular cloning of the murine JAK1 protein tyrosine kinase and its expression in the mouse central nervous system.Yang X., Chung D., Cepko C.L.J. Neurosci. 13:3006-3017(1993)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway. Kinase partner for the interleukin (IL)-2 receptor.
Subcellular Location	Endomembrane system, Peripheral membrane protein
Protein Families	Protein kinase superfamily, Tyr protein kinase family, JAK subfamily
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP011930MO-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen