ArtNr |
CSB-EP010947HU(F1)-1 |
Hersteller |
Cusabio
|
Menge |
1mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
69KDA islet cell autoantigen,Short name:,ICA69,Islet cell autoantigen p69,Short name:,ICAp69,Short name:,p69 |
Lieferbar |
|
Research Areas |
Neuroscience |
Uniprot ID |
Q05084 |
Gene Names |
ICA1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MSGHKCYPWDLQDRYAQDKSVVNKMQQKYWETKQA FIKATGKKEDEHVVASDADLDAKLELFHSIQRTCL DLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDK TRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEV ETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDV SQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMD VCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTS HTMAAIHESFKGYQPYEFTTLKSLQDPMKKLVEKE EKKKINQQESTDAAVQEPSQLISLEEENQRKESSS FKTEDGKSILSALDKGSTHTACSGPIDELLDMKSE EGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLE EGEFSKEWAAVFGDGQVKEPVPTMALGEPDPKAQT GSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWF SLFADLDPLSNPDAVGKTDKEHELLNA |
Expression Region |
1-482aa |
Sequence Info |
Full Length of Isoform 3 |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
60.1 kDa |
Alternative Name(s) |
69KDA islet cell autoantigen Short name: ICA69 Islet cell autoantigen p69 Short name: ICAp69 Short name: p69 |
Relevance |
May play a role in neurotransmitter secretion. |
Reference |
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).The MGC Project Team Genome Res. 14:2121-2127(2004). |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
May play a role in neurotransmitter secretion. |
Subcellular Location |
Cytoplasm, cytosol, Golgi apparatus membrane, Peripheral membrane protein, Cytoplasmic vesicle, secretory vesicle membrane, Peripheral membrane protein, Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Peripheral membrane protein |
Tissue Specificity |
Expressed abundantly in pancreas, heart and brain with low levels of expression in lung, kidney, liver and thyroid. |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.