« Zurück
Home /
Recombinant Human Heterogeneous nuclear ribonucleoprotein A3(HNRNPA3)

Recombinant Human Heterogeneous nuclear ribonucleoprotein A3(HNRNPA3)

ArtNr	CSB-EP010603HU-10
Hersteller	Cusabio
Menge	10ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Epigenetics and Nuclear Signaling
Uniprot ID	P51991
Gene Names	HNRNPA3
Organism	Homo sapiens (Human)
AA Sequence	MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLR KLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDP QTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVV EPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEY NLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFD DHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSA GSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGNFGG RGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGG PGYSSRGGYGGGGPGYGNQGGGYGGGGGYDGYNEG GNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGS FGGRSSGSPYGGGYGSGGGSGGYGSRRF
Expression Region	1-378aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW	46.6 kDa
Alternative Name(s)	hnRNP A3(HNRPA3)
Relevance	Plays a role in cytoplasmic trafficking of RNA. Binds to the cis-acting response element, A2RE. May be involved in pre-mRNA splicing.
Reference	"Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line." Giorgianni F., Zhao Y., Desiderio D.M., Beranova-Giorgianni S. Electrophoresis 28:2027-2034(2007)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays a role in cytoplasmic trafficking of RNA. Binds to the cis-acting response element, A2RE. May be involved in pre-mRNA splicing.
Subcellular Location	Nucleus
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP010603HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen