ArtNr |
CSB-EP009514MO1-50 |
Hersteller |
Cusabio
|
Menge |
50ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Short name:,GLP-1 receptor,Short name:,GLP-1-R,Short name:,GLP-1R |
Lieferbar |
|
Research areas |
Neuroscience |
Target / Protein |
Glp1r |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Mus musculus (Mouse) |
Uniprot ID |
O35659 |
AA Sequence |
GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLL ATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPW ASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSEC EESKRGERNFPEEQLLSLY |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
22-145aa |
Protein length |
Partial |
MW |
30.4 kDa |
Alternative Name(s) |
Short name: GLP-1 receptor Short name: GLP-1-R Short name: GLP-1R |
Relevance |
This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. |
References |
"Mouse pancreatic beta-cells exhibit preserved glucose competence after disruption of the glucagon-like peptide-1 receptor gene."Flamez D., van Breusegem A., Scrocchi L.A., Quartier E., Pipeleers D., Drucker D.J., Schuit F.Diabetes 47:646-652(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
G-protein coupled receptor for glucagon-like peptide 1 (GLP-1) |
Subcellular Location |
Cell membrane, Multi-pass membrane protein |
Protein Families |
G-protein coupled receptor 2 family |
Tissue Specificity |
Detected in pancreatic islets (at protein level). Detected in pancreatic islets and lungs. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.