ArtNr |
CSB-EP008629RA-10 |
Hersteller |
Cusabio
|
Menge |
10ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Research areas |
Others |
Target / Protein |
Fgf23 |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Rattus norvegicus (Rat) |
Uniprot ID |
Q8VI82 |
AA Sequence |
YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDG HVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFL CMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLS PKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEV PLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRA TPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDA RRGAGGTDRCRPFPRFV |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
25-251aa |
Protein length |
Full Length of Mature Protein |
MW |
29.5 kDa |
Relevance |
Regulator of phosphate homeostasis . Inhibits renal tubular phosphate transport by reducing SLC34A1 levels . Regulator of vitamin-D metabolism . Negatively regulates osteoblasts differentiation and matrix mineralization . Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL. |
References |
Rattus norvegicus fgf23.Itoh N.Klotho converts canonical FGF receptor into a specific receptor for FGF23.Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T.Nature 444:770-774(2006) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Regulator of phosphate homeostasis (By similarity). Inhibits renal tubular phosphate transport by reducing SLC34A1 levels (By similarity). Regulator of vitamin-D metabolism (By similarity). Negatively regulates osteoblasts differentiation and matrix mineralization (By similarity). Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL. |
Subcellular Location |
Secreted |
Protein Families |
Heparin-binding growth factors family |
Tissue Specificity |
Expressed in the parathyroid. |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.