ArtNr |
CSB-EP008608HU-500 |
Hersteller |
Cusabio
|
Menge |
500ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Research Topic |
Cardiovascular |
Uniprot ID |
P02675 |
Gene Names |
FGB |
Organism |
Homo sapiens (Human) |
AA Sequence |
GHRPLDKKREEAPSLRPAPPPISGGGYRARPAKAA ATQKKVERKAPDAGGCLHADPDLGVLCPTGCQLQE ALLQQERPIRNSVDELNNNVEAVSQTSSSSFQYMY LLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYID ETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQ MEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEM YLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGS VDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWL GNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGF TVQNEANKYQISVNKYRGTAGNALMDGASQLMGEN RTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDG GGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDG VVWMNWKGSWYSMRKMSMKIRPFFPQQ |
Expression Region |
45-491aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
54.8 kDa |
Relevance |
Cleaved by the protease thrombin to yield monomers which, together with fibrinogen alpha (FGA) and fibrinogen gamma (FGG), polymerize to form an insoluble fibrin matrix. Fibrin has a major function in hemostasis as one of the primary components of blood clots. In addition, functions during the early stages of wound repair to stabilize the lesion and guide cell migration during re-epithelialization. Was originally thought to be essential for platelet aggregation, based on in vitro studies using anticoagulated blood. However subsequent studies have shown that it is not absolutely required for thrombus formation in vivo. Enhances expression of SELP in activated platelets. Maternal fibrinogen is essential for successful pregnancy. Fibrin deposition is also associated with infection, where it protects against IFNG-mediated hemorrhage. May also facilitate the antibacterial immune response via both innate and T-cell mediated pathways. |
Reference |
"Characterization of complementary deoxyribonucleic acid and genomic deoxyribonucleic acid for the beta chain of human fibrinogen."Chung D.W., Que B.G., Rixon M.W., Mace M. Jr., Davie E.W.Biochemistry 22:3244-3250(1983) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Cleaved by the protease thrombin to yield monomers which, together with fibrinogen alpha (FGA) and fibrinogen gamma (FGG), polymerize to form an insoluble fibrin matrix. Fibrin has a major function in hemostasis as one of the primary components of blood clots. In addition, functions during the early stages of wound repair to stabilize the lesion and guide cell migration during re-epithelialization. Was originally thought to be essential for platelet aggregation, based on in vitro studies using anticoagulated blood. However subsequent studies have shown that it is not absolutely required for thrombus formation in vivo. Enhances expression of SELP in activated platelets. Maternal fibrinogen is essential for successful pregnancy. Fibrin deposition is also associated with infection, where it protects against IFNG-mediated hemorrhage. May also facilitate the antibacterial immune response via both innate and T-cell mediated pathways. |
Involvement in disease |
Congenital afibrinogenemia (CAFBN); Dysfibrinogenemia, congenital (DYSFIBRIN) |
Subcellular Location |
Secreted |
Tissue Specificity |
Detected in blood plasma (at protein level). |
Paythway |
Complementandcoagulationcascades |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.