« Zurück
Home /
Recombinant Rat Fatty acid-binding protein, heart(Fabp3)

Recombinant Rat Fatty acid-binding protein, heart(Fabp3)

ArtNr	CSB-EP007943RA-500
Hersteller	Cusabio
Menge	500ug
Kategorie	Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Fatty acid-binding protein 3,Heart-type fatty acid-binding protein,Short name:,H-FABP
Lieferbar
Research Topic	Cardiovascular
Uniprot ID	P07483
Gene Names	Fabp3
Organism	Rattus norvegicus (Rat)
AA Sequence	ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASM TKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEF DEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLT RELSDGKLILTLTHGNVVSTRTYEKEA
Expression Region	2-133aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	30.6 kDa
Alternative Name(s)	Fatty acid-binding protein 3 Heart-type fatty acid-binding protein Short name: H-FABP
Relevance	FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Reference	"Cloning and tissue distribution of rat heart fatty acid binding protein mRNA: identical forms in heart and skeletal muscle."Claffey K.P., Herrera V.L., Brecher P., Ruiz-Opazo N.Biochemistry 26:7900-7904(1987)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Subcellular Location	Cytoplasm
Protein Families	Calycin superfamily, Fatty-acid binding protein (FABP) family
Tissue Specificity	Heart, but also skeletal muscle, kidney, brain and mammary gland.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP007943RA-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen