« Zurück
Home /
Recombinant Human Proepiregulin(EREG),partial

Recombinant Human Proepiregulin(EREG),partial

ArtNr	CSB-EP007779HU-100
Hersteller	Cusabio
Menge	100ug
Kategorie	Oncology Neuroscience Neural Signaling Peptides & Proteins Recombinant Proteins By Organ Bladder Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Epiregulin,Short name:,EPR
Lieferbar
Research Areas	Cancer
Uniprot ID	O14944
Gene Names	EREG
Organism	Homo sapiens (Human)
AA Sequence	VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRC EVGYTGVRCEHFFLTVHQPLSKEYV
Expression Region	60-119aa
Sequence Info	Extracellular Domain
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	22.9 kDa
Alternative Name(s)	Epiregulin Short name: EPR
Relevance	Ligand of the EGF receptor/EGFR and ERBB4. May be a mediator of localized cell proliferation. As a mitogen it may stimulate cell proliferation and/or angiogenesis.
Reference	Distribution of mRNA for human epiregulin, a differentially expressed member of the epidermal growth factor family.Toyoda H., Komurasaki T., Uchida D., Morimoto S.Biochem. J. 326:69-75(1997)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Ligand of the EGF receptor/EGFR and ERBB4. Stimulates EGFR and ERBB4 tyrosine phosphorylation
Subcellular Location	Epiregulin: Secreted, extracellular space, SUBCELLULAR LOCATION: Proepiregulin: Cell membrane, Single-pass type I membrane protein
Tissue Specificity	In normal adults, expressed predominantly in the placenta and peripheral blood leukocytes. High levels were detected in carcinomas of the bladder, lung, kidney and colon.
Paythway	ErbBsignalingpathway
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP007779HU-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen