« Zurück
Home /
Recombinant Pig Erythropoietin(EPO)

Recombinant Pig Erythropoietin(EPO)

ArtNr	CSB-EP007743PI-10
Hersteller	Cusabio
Menge	10ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research areas	Cardiovascular
Target / Protein	EPO
Biologically active	Not Test
Expression system	E.coli
Species of origin	Sus scrofa (Pig)
Uniprot ID	P49157
AA Sequence	APPRLICDSRVLERYILEAKEGENATMGCAESCSF SENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALL SEAILQGQALLANSSQPSEALQLHVDKAVSGLRSL TSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTL CKLFRNYSNFLRGKLTLYTGEACRRRDR
Tag Info	N-terminal 6xHis-B2M-tagged
Expression Region	27-194aa
Protein length	Full Length of Mature Protein
MW	32.6 kDa
Relevance	Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
References	"The porcine erythropoietin gene: cDNA sequence, genomic sequence and expression analyses in piglets." David R.B., Blom A.K., Sjaastad O.V., Harbitz I. Domest. Anim. Endocrinol. 20:137-147(2001)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.
Subcellular Location	Secreted
Protein Families	EPO/TPO family
Tissue Specificity	Produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.
Tag Information	N-terminal 6xHis-B2M-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP007743PI-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen