« Zurück
Home /
Recombinant Human Docking protein 5(DOK5),partial

Recombinant Human Docking protein 5(DOK5),partial

ArtNr	CSB-EP007111HU-10
Hersteller	Cusabio
Menge	10ug
Kategorie	Oncology Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Peptides & Proteins Recombinant Proteins By Organ Colorectal Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Downstream of tyrosine kinase 5Insulin receptor substrate 6 ;IRS-6 ;IRS6
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	Q9P104
Gene Names	DOK5
Organism	Homo sapiens (Human)
AA Sequence	MECVGTRINDISLGEPDLLATGVEREQSERFNVYL MPSPNLDVHGECALQITYEYICLWDVQNPRVKLIS WPLSALRRYGRDTTWFTFEAGRMCETGEGLFIFQT RDGEAIYQKVHSAALAIAEQHERLLQSVKNSMLQM KMSERAASLSTMVPLPRSAYWQHITRQHSTGQLYR LQDVSSPLKLHRTETFPAYRSEH
Expression Region	1-198aa
Sequence Info	Partial of Isoform 2
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	38.8 kDa
Alternative Name(s)	Downstream of tyrosine kinase 5Insulin receptor substrate 6 ; IRS-6 ; IRS6
Relevance	DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assbly of multimolecular signaling complexes. DOK5 functions in RET-mediated neurite outgrowth and plays a positive role in activation of the MAP kinase pathway. Putative link with downstream effectors of RET in neuronal differentiation.
Reference	The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK5 functions in RET-mediated neurite outgrowth and plays a positive role in activation of the MAP kinase pathway. Putative link with downstream effectors of RET in neuronal differentiation.
Protein Families	DOK family, Type B subfamily
Tissue Specificity	Highest expression in skeletal muscle, lower in brain, heart and kidney. Also detected in activated peripheral blood T-lymphocytes.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP007111HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen