ArtNr |
CSB-EP006463HU-10 |
Hersteller |
Cusabio
|
Menge |
10ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
CCN family member 1,Cysteine-rich angiogenic inducer 61,Insulin-like growth factor-binding protein 10,Short name:,IBP-10,Short name:,IGF-binding protein 10,Short name:,IGFBP-10,Protein GIG1 |
Lieferbar |
|
Research areas |
Stem Cells |
Target / Protein |
CYR61 |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
O00622 |
AA Sequence |
TCPAACHCPLEAPKCAPGVGLVRDGCGCCKVCAKQ LNEDCSKTQPCDHTKGLECNFGASSTALKGICRAQ SEGRPCEYNSRIYQNGESFQPNCKHQCTCIDGAVG CIPLCPQELSLPNLGCPNPRLVKVTGQCCEEWVCD EDSIKDPMEDQDGLLGKELGFDASEVELTRNNELI AVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTT SWSQCSKTCGTGISTRVTNDNPECRLVKETRICEV RPCGQPVYSSLKKGKKCSKTKKSPEPVRFTYAGCL SVKKYRPKYCGSCVDGRCCTPQLTRTVKMRFRCED GETFSKNVMMIQSCKCNYNCPHANEAAFPFYRLFN DIHKFRD |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
25-381aa |
Protein length |
Full Length of Mature Protein |
MW |
55.4 kDa |
Alternative Name(s) |
CCN family member 1 Cysteine-rich angiogenic inducer 61 Insulin-like growth factor-binding protein 10 Short name: IBP-10 Short name: IGF-binding protein 10 Short name: IGFBP-10 Protein GIG1 |
Relevance |
Promotes cell proliferation, chemotaxis, angiogenesis and cell adhesion. Appears to play a role in wound healing by up-regulating, in skin fibroblasts, the expression of a number of genes involved in angiogenesis, inflammation and matrix remodeling including VEGA-A, VEGA-C, MMP1, MMP3, TIMP1, uPA, PAI-1 and integrins alpha-3 and alpha-5. CYR61-mediated gene regulation is dependent on heparin-binding. Down-regulates the expression of alpha-1 and alpha-2 subunits of collagen type-1. Promotes cell adhesion and adhesive signaling through integrin alpha-6/beta-1, cell migration through integrin alpha-v/beta-5 and cell proliferation through integrin alpha-v/beta-3. |
References |
"The angiogenic factor Cyr61 activates a genetic program for wound healing in human skin fibroblasts."Chen C.-C., Mo F.-E., Lau L.F.J. Biol. Chem. 276:47329-47337(2001) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Promotes cell proliferation, chemotaxis, angiogenesis and cell adhesion. Appears to play a role in wound healing by up-regulating, in skin fibroblasts, the expression of a number of genes involved in angiogenesis, inflammation and matrix remodeling including VEGA-A, VEGA-C, MMP1, MMP3, TIMP1, uPA, PAI-1 and integrins alpha-3 and alpha-5. CYR61-mediated gene regulation is dependent on heparin-binding. Down-regulates the expression of alpha-1 and alpha-2 subunits of collagen type-1. Promotes cell adhesion and adhesive signaling through integrin alpha-6/beta-1, cell migration through integrin alpha-v/beta-5 and cell proliferation through integrin alpha-v/beta-3. |
Subcellular Location |
Secreted |
Protein Families |
CCN family |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.