ArtNr |
CSB-EP005453MO-500 |
Hersteller |
Cusabio
|
Menge |
500 ug |
Quantity options |
1 mg
10 ug
100 ug
200 ug
20 ug
50 ug
500 ug
|
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Konjugat/Tag |
Myc, HIS |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Sequence |
VLEEVQQVRRGHQDFSRQRDELGQGLQGVEQKVQS LQATFGTFESLLRNSQHKQDLTEKAVKEGESELNR ISEVLQKLQNEILKDLSDGIHVVKDARERDFTSLE NTVEERLTELTKSINDNIAIFTDVQKRSQKEINEV KMKVASLEESKGDRSQDVKTLKDAVKEVQASMMSR ERDIEALKSSLQTMESDVYTEVRELVSLKQEQQAF KQAADSERLALQALTEKLLRSEESSSRLPEDIRRL EEE |
Citations |
"Global survey of organ and organelle protein expression in mouse: combined proteomic and transcriptomic profiling." Kislinger T., Cox B., Kannan A., Chung C., Hu P., Ignatchenko A., Scott M.S., Gramolini A.O., Morris Q., Hallett M.T., Rossant J., Hughes T.R., Frey B., Emili A. Cell 125:173-186(2006) |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
63-kDa cytoskeleton-linking membrane protein; Short name:; Climp-63; Short name:; p63 |
Lieferbar |
|
Manufacturer - Targets |
Ckap4 |
Manufacturer - Conjugate / Tag |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Storage Conditions |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Molecular Weight |
57.6 kDa |
General Research Areas |
Cancer |
Relevance |
High-affinity epithelial cell surface receptor for APF. Mediates the anchoring of the endoplasmic reticulum to microtubules. |
Expression Region |
109-575aa |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
High-affinity epithelial cell surface receptor for APF. |
Subcellular Location |
Endoplasmic reticulum membrane, Single-pass type II membrane protein, Cell membrane, Single-pass type II membrane protein, Cytoplasm, cytoskeleton, Cytoplasm, perinuclear region |
Biologically active |
Not Test |
Protein length |
Partial |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.