« Zurück
Home /
Recombinant Mouse Cytoskeleton-associated protein 4(Ckap4),partial

Recombinant Mouse Cytoskeleton-associated protein 4(Ckap4),partial

ArtNr	CSB-EP005453MO-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Mouse (Murine, Mus musculus)
Host	E.coli
Konjugat/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	VLEEVQQVRRGHQDFSRQRDELGQGLQGVEQKVQS LQATFGTFESLLRNSQHKQDLTEKAVKEGESELNR ISEVLQKLQNEILKDLSDGIHVVKDARERDFTSLE NTVEERLTELTKSINDNIAIFTDVQKRSQKEINEV KMKVASLEESKGDRSQDVKTLKDAVKEVQASMMSR ERDIEALKSSLQTMESDVYTEVRELVSLKQEQQAF KQAADSERLALQALTEKLLRSEESSSRLPEDIRRL EEE
Citations	Global survey of organ and organelle protein expression in mouse: combined proteomic and transcriptomic profiling. Kislinger T., Cox B., Kannan A., Chung C., Hu P., Ignatchenko A., Scott M.S., Gramolini A.O., Morris Q., Hallett M.T., Rossant J., Hughes T.R., Frey B., Emili A. Cell 125:173-186(2006)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	63-kDa cytoskeleton-linking membrane protein; Short name:; Climp-63; Short name:; p63
Lieferbar
Manufacturer - Targets	Ckap4
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	57.6 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Cancer
Relevance	High-affinity epithelial cell surface receptor for APF. Mediates the anchoring of the endoplasmic reticulum to microtubules.
Biologically Active	Not Test
Expression Region	109-575aa
Protein Length	Partial
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	High-affinity epithelial cell surface receptor for APF.
Subcellular Location	Endoplasmic reticulum membrane, Single-pass type II membrane protein, Cell membrane, Single-pass type II membrane protein, Cytoplasm, cytoskeleton, Cytoplasm, perinuclear region

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP005453MO-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 07.02.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail