« Zurück
Home /
Recombinant Human Carbonic anhydrase-related protein(CA8)

Recombinant Human Carbonic anhydrase-related protein(CA8)

ArtNr	CSB-EP004379HU-50
Hersteller	Cusabio
Menge	50ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Carbonic anhydrase VIII
Lieferbar
Research Topic	Cancer
Uniprot ID	P35219
Gene Names	CA8
Organism	Homo sapiens (Human)
AA Sequence	MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGV EWGLVFPDANGEYQSPINLNSREARYDPSLLDVRL SPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLP QGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMEL HLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKE HVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDP LLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQL QIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPL SDRVIRAAFQ
Expression Region	1-290aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	60 kDa
Alternative Name(s)	Carbonic anhydrase VIII
Relevance	Does not have a carbonic anhydrase catalytic activity.
Reference	"The deduced amino acid sequence of human carbonic anhydrase-related protein (CARP) is 98% identical to the mouse homologue." Skaggs L.A., Bergenhem N.C.H., Venta P.J., Tashian R.E. Gene 126:291-292(1993)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Does not have a carbonic anhydrase catalytic activity.
Involvement in disease	Cerebellar ataxia, mental retardation, and dysequilibrium syndrome 3 (CMARQ3)
Protein Families	Alpha-carbonic anhydrase family
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP004379HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen