ArtNr |
CSB-EP002613HU-10 |
Hersteller |
Cusabio
|
Menge |
10ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Apoptosis regulator Bcl-X |
Lieferbar |
|
Research Topic |
Cancer |
Uniprot ID |
Q07817 |
Gene Names |
BCL2L1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRT EAPEGTESEMETPSAINGNPSWHLADSPAVNGATG HSSSLDAREVIPMAAVKQALREAGDEFELRYRRAF SDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRI VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLN DHLEPWIQENGGWDTFVELYGNNAAAESRKGQER |
Expression Region |
1-209aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
39.4 kDa |
Alternative Name(s) |
Apoptosis regulator Bcl-X |
Relevance |
Potent inhibitor of cell death. Inhibits activation of caspases. Appears to regulate cell death by blocking the voltage-dependent anion channel (VDAC) by binding to it and preventing the release of the caspase activator, CYC1, from the mitochondrial mbrane. Also acts as a regulator of G2 checkpoint and progression to cytokinesis during mitosis.Isoform Bcl-X(L) also regulates presynaptic plasticity, including neurotransmitter release and recovery, number of axonal mitochondria as well as size and number of synaptic vesicle clusters. During synaptic stimulation, increases ATP availability from mitochondria through regulation of mitochondrial mbrane ATP synthase F1F0 activity and regulates endocytic vesicle retrieval in hippocampal neurons through association with DMN1L and stimulation of its GTPase activity in synaptic vesicles.Isoform Bcl-X(S) promotes apoptosis. |
Reference |
bcl-x, a bcl-2-related gene that functions as a dominant regulator of apoptotic cell death.Boise L.H., Gonzalez-Garcia M., Postema C.E., Ding L., Lindsten T., Turka L.A., Mao X., Nunez G., Thompson C.B.Cell 74:597-608(1993) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Potent inhibitor of cell death. Inhibits activation of caspases. Appears to regulate cell death by blocking the voltage-dependent anion channel (VDAC) by binding to it and preventing the release of the caspase activator, CYC1, from the mitochondrial membrane. Also acts as a regulator of G2 checkpoint and progression to cytokinesis during mitosis.; FUNCTION |
Subcellular Location |
Isoform Bcl-X(L): Mitochondrion inner membrane, Mitochondrion outer membrane, Mitochondrion matrix, Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Cytoplasm, cytosol, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Nucleus membrane, Single-pass membrane protein, Cytoplasmic side |
Protein Families |
Bcl-2 family |
Tissue Specificity |
Bcl-X(S) is expressed at high levels in cells that undergo a high rate of turnover, such as developing lymphocytes. In contrast, Bcl-X(L) is found in tissues containing long-lived postmitotic cells, such as adult brain. |
Paythway |
Jak-STATsignalingpathway |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.