« Zurück
Home /
Recombinant Human Potassium-transporting ATPase subunit beta(ATP4B),Partial

Recombinant Human Potassium-transporting ATPase subunit beta(ATP4B),Partial

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	50ug
ArtNr	CSB-EP002343HUe1-50
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Purity	Greater than 85% as determined by SDS-PAGE.
Research areas	Signal Transduction
Target / Protein	ATP4B
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P51164
AA Sequence	CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEK GLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQED SINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNC SGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAP RVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPY YGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMA EHVTFNNPHDPYEGKVEFKLKIEK
Tag Info	Tag-Free
Expression Region	58-291aa
Protein length	Extracellular Domain
MW	26.6 kDa
Alternative Name(s)	Gastric H(+)/K(+) ATPase subunit beta Proton pump beta chain
Relevance	Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.
References	"A C-terminal lobe of the beta subunit of Na, K-ATPase and H, K-ATPase resembles cell adhesion molecules." Bab-Dinitz E., Albeck S., Peleg Y., Brumfeld V., Gottschalk K.E., Karlish S.J. Biochemistry 48:8684-8691(2009)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.
Subcellular Location	Cell membrane, Single-pass type II membrane protein
Protein Families	X(+)/potassium ATPases subunit beta family
Paythway	OxidativePhosphorylation
Tag Information	Tag-Free

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen