« Zurück
Home /
Recombinant Human Aspartoacylase(ASPA)

Recombinant Human Aspartoacylase(ASPA)

ArtNr	CSB-EP002223HU-50
Hersteller	Cusabio
Menge	50ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	P45381
Gene Names	ASPA
Organism	Homo sapiens (Human)
AA Sequence	MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWL ENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLN RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDS EDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMF HYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPV GIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFN EGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHP NLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYP VFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH
Expression Region	1-313aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW	42.7 kDa
Alternative Name(s)	Aminoacylase-2 Short name: ACY-2 ACY2, ASP
Relevance	Catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter. In other tissues it act as a scavenger of NAA from body fluids.
Reference	"The spectrum of mutations of the aspartoacylase gene in Canavan disease in non-Jewish patients." Elpeleg O.N., Shaag A. J. Inherit. Metab. Dis. 22:531-534(1999)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter. In other tissues it act as a scavenger of NAA from body fluids.
Involvement in disease	Canavan disease (CAND)
Subcellular Location	Cytoplasm, Nucleus
Protein Families	AspA/AstE family, Aspartoacylase subfamily
Tissue Specificity	Brain white matter, skeletal muscle, kidney, adrenal glands, lung and liver.
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP002223HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen