ArtNr |
CSB-EP002208MO1b3-500 |
Hersteller |
Cusabio
|
Menge |
500ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Konjugat/Tag |
Myc |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Research areas |
Signal Transduction |
Target / Protein |
Asgr2 |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Mus musculus (Mouse) |
Uniprot ID |
P24721 |
AA Sequence |
QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGG STNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFP MDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWF SRDGLTWAEADQYCQLENAHLLVINSREEQDFVVK HRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAF TQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVN RWVCEKRRNITH |
Tag Info |
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
Expression Region |
80-301aa |
Protein length |
Extracellular Domain |
MW |
45.9 kDa |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface. |
Subcellular Location |
Membrane, Single-pass type II membrane protein |
Tissue Specificity |
Expressed exclusively in hepatic parenchymal cells. |
Tag Information |
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.