« Zurück
Home /
Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2),Partial

Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2),Partial

ArtNr	CSB-EP002208MO1b3-500
Hersteller	Cusabio
Menge	500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	Myc
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research areas	Signal Transduction
Target / Protein	Asgr2
Biologically active	Not Test
Expression system	E.coli
Species of origin	Mus musculus (Mouse)
Uniprot ID	P24721
AA Sequence	QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGG STNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFP MDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWF SRDGLTWAEADQYCQLENAHLLVINSREEQDFVVK HRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAF TQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVN RWVCEKRRNITH
Tag Info	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region	80-301aa
Protein length	Extracellular Domain
MW	45.9 kDa
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.
Subcellular Location	Membrane, Single-pass type II membrane protein
Tissue Specificity	Expressed exclusively in hepatic parenchymal cells.
Tag Information	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen