« Zurück
Home /
Recombinant Rabbit Apolipoprotein E(APOE),partial

Recombinant Rabbit Apolipoprotein E(APOE),partial

ArtNr	CSB-EP001936RBb7-1
Hersteller	Cusabio
Menge	1mg
Kategorie	Oncology Neuroscience Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Rabbit
Konjugat/Tag	Myc
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Areas	Cardiovascular
Target / Protein	APOE
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Oryctolagus cuniculus (Rabbit)
Uniprot ID	P18287
AA Sequence	TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQS LSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSE LEEQLSPMAQEHRARLSKELQVAGALEADMEDVCN RLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRL LRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGS RLERGRLRVATVGTLAGRPLRERAQAWGERLRGHL EEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQ AEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMP SKAPAAAPIENQ
Tag Info	N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged
Expression Region	20-311aa
Protein Length	Partial
MW	50.6 kDa
Relevance	Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.
Reference	Isolation and characterization of a full-length rabbit apolipoprotein E cDNA. Hao Q.L., Yamin T.T., Pan T.C., Chen S.L., Chen B.S., Kroon P.A., Chao Y.S. Atherosclerosis 66:125-130(1987)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.
Subcellular Location	Secreted
Protein Families	Apolipoprotein A1/A4/E family
Tissue Specificity	Secreted in plasma.
Tag Information	N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen