« Zurück
Home /
Recombinant Human Annexin A2(ANXA2)

Recombinant Human Annexin A2(ANXA2)

ArtNr	CSB-EP001840HUe0-500
Hersteller	Cusabio
Menge	500ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	P07355
Gene Names	ANXA2
Organism	Homo sapiens (Human)
AA Sequence	STVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAE RDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDI AFAYQRRTKKELASALKSALSGHLETVILGLLKTP AQYDASELKASMKGLGTDEDSLIEIICSRTNQELQ EINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAK GRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVP KWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRK EVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGK GTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLY YYIQQDTKGDYQKALLYLCGGDD
Expression Region	2-339aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	65.6 kDa
Alternative Name(s)	Annexin IIAnnexin-2; Calpactin I heavy chain; Calpactin-1 heavy chain; Chromobindin-8Lipocortin IIPlacental anticoagulant protein IV ; PAP-IVProtein Ip36
Relevance	Calcium-regulated mbrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response.
Reference	Two human 35 kd inhibitors of phospholipase A2 are related to substrates of pp60v-src and of the epidermal growth factor receptor/kinase.Huang K.-S., Wallner B.P., Mattaliano R.J., Tizard R., Burne C., Frey A., Hession C., McGray P., Sinclair L.K., Chow E.P., Browning J.L., Ramachandran K.L., Tang J., Smart J.E., Pepinsky R.B.Cell 46:191-199(1986)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response. Inhibits PCSK9-enhanced LDLR degradation, probably reduces PCSK9 protein levels via a translational mechanism but also competes with LDLR for binding with PCSK9
Subcellular Location	Secreted, extracellular space, extracellular matrix, basement membrane, Melanosome
Protein Families	Annexin family
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen