« Zurück
Home /
Recombinant Lactococcus lactis subsp.lactis Prolipoprotein diacylglyceryl transferase(lgt)

Recombinant Lactococcus lactis subsp.lactis Prolipoprotein diacylglyceryl transferase(lgt)

ArtNr	CSB-CF875009LNG-10
Hersteller	Cusabio
Menge	10ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Others
Uniprot ID	Q9CHU9
Gene Names	lgt
Organism	Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
AA Sequence	MNNLFPFLALNKIALQLGPLAIHWYAIFIVGGAAL AVWLACKEAPKRNIKTDDIIDFVLFAFPLGIVGAR LYYVIFQWSYYSQHPSQIIAMWDGGGAIYGSLIAG AIVLFVFSYYRMIHPLDLLDITIPGVFLAQAMGRW GNFVNQEAYGKIVSNLDWLPAFIRNQMFIDGHYRM PTFLFESIGTLSGFILVMVFRHRIKGLKRGDIFSF YLVWYGAVRFIVEGMRTDSLMLGPARVSQWLSVLL VIVGLVLFIYRRMKKN
Expression Region	1-261aa
Sequence Info	Full Length
Source	in vitro E.coli expression system
Tag Info	C-terminal 6xHis-tagged
MW	32.6 kDa
Relevance	Transfers the N-acyl diglyceride group on what will become the N-terminal cysteine of membrane lipoproteins.
Reference	"The complete genome sequence of the lactic acid bacterium Lactococcus lactis ssp. lactis IL1403." Bolotin A., Wincker P., Mauger S., Jaillon O., Malarme K., Weissenbach J., Ehrlich S.D., Sorokin A. Genome Res. 11:731-753(2001)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Transfers the N-acyl diglyceride group on what will become the N-terminal cysteine of membrane lipoproteins.
Subcellular Location	Cell membrane, Multi-pass membrane protein
Protein Families	Lgt family
Tag Information	C-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-CF875009LNG-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen