Vergleich

Recombinant Human BPI fold-containing family A member 1(BPIFA1)

ArtNr CSB-CF868269HU-50
Hersteller Cusabio
Menge 50ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Purity Greater than 90% as determined by SDS-PAGE.
ECLASS 5.1 34160400
ECLASS 6.1 34160400
ECLASS 8.0 42020190
ECLASS 9.0 42020190
ECLASS 10.0.1 32160409
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Lung-specific protein X,Nasopharyngeal carcinoma-related protein,Palate lung and nasal epithelium clone protein,Secretory protein in upper respiratory tracts,Short PLUNC1,Short name:,SPLUNC1,Tracheal epithelium-enriched protein,Von Ebner protein Hl
Lieferbar
Research Topic
Cancer
Uniprot ID
Q9NP55
Gene Names
BPIFA1
Organism
Homo sapiens(Human)
AA Sequence
QFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNA LSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLG GLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSP DGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDI TAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDG LGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNE VLRGLDITLVHDIVNMLIHGLQFVIKV
Expression Region
20-256aa
Sequence Info
Full Length of Mature Protein
Source
in vitro E.coli expression system
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
40.7 kDa
Alternative Name(s)
Lung-specific protein X
Nasopharyngeal carcinoma-related protein
Palate lung and nasal epithelium clone protein
Secretory protein in upper respiratory tracts
Short PLUNC1
Short name:
SPLUNC1
Tracheal epithelium-enriched protein
Von Ebner protein Hl
Relevance
Plays a role in the innate immune responses of the upper airways. Reduces the surface tension in secretions from airway epithelia and inhibits the formation of biofilm by pathogenic Gram-negative bacteria, such as P.aeruginosa and K.pneumoniae. Binds bacterial lipopolysaccharide (LPS). Negatively regulates proteolytic cleavage of SCNN1G, an event that is required for activation of the epithelial sodium channel (ENaC), and thereby contributes to airway surface liquid homeostasis and proper clearance of mucus. Plays a role in the airway inflammatory response after exposure to irritants. May attract macrophages and neutrophils. May be associated with tumor progression.
Reference
"Isolation of a novel human lung-specific gene, LUNX, a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer."Iwao K., Watanabe T., Fujiwara Y., Takami K., Kodama K., Higashiyama M., Yokouchi H., Ozaki K., Monden M., Tanigami A.Int. J. Cancer 91:433-437(2001)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Plays a role in the innate immune responses of the upper airways. Reduces the surface tension in secretions from airway epithelia and inhibits the formation of biofilm by pathogenic Gram-negative bacteria, such as P.aeruginosa and K.pneumoniae. Binds bacterial lipopolysaccharide (LPS). Negatively regulates proteolytic cleavage of SCNN1G, an event that is required for activation of the epithelial sodium channel (ENaC), and thereby contributes to airway surface liquid homeostasis and proper clearance of mucus. Plays a role in the airway inflammatory response after exposure to irritants. May attract macrophages and neutrophils. May be associated with tumor progression.
Subcellular Location
Secreted
Protein Families
BPI/LBP/Plunc superfamily, Plunc family
Tissue Specificity
Lung, upper airways and nasopharyngeal regions, including trachea and nasal epithelium. Specifically expressed in the secretory ducts and submucosal glands of tracheobronchial tissues. Highest expression in the trachea and progressive decrease from proximal (bronchial) to distal (bronchiolar) airways. Also expressed in lung cancers and some other types of cancer.
Tag Information
N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen