« Zurück
Home /
Recombinant Human Zinc transporter 8(SLC30A8)

Recombinant Human Zinc transporter 8(SLC30A8)

ArtNr	CSB-CF818247HU-100
Hersteller	Cusabio
Menge	100ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Human
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Areas	Others
Target / Protein	SLC30A8
Biologically Active	Not Test
Expression System	in vitro E.coli expression system
Species of origin	Homo sapiens (Human)
Uniprot ID	Q8IWU4
AA Sequence	MEFLERTYLVNDKAAKMYAFTLESVELQQKPVNKD QCPRERPEELESGGMYHCHSGSKPTEKGANEYAYA KWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAA HLLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAE ILGALLSILCIWVVTGVLVYLACERLLYPDYQIQA TVMIIVSSCAVAANIVLTVVLHQRCLGHNHKEVQA NASVRAAFVHALGDLFQSISVLISALIIYFKPEYK IADPICTFIFSILVLASTITILKDFSILLMEGVPK SLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVIL SAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQ MESPVDQDPDCLFCEDPCD
Tag Info	N-terminal 10xHis-tagged
Expression Region	1-369aa
Protein Length	Full Length
MW	43.6 kDa
Alternative Name(s)	Solute carrier family 30 member 8 (ZNT8)
Relevance	Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells.
Reference	In vivo expression and functional characterization of the zinc transporter ZnT8 in glucose-induced insulin secretion. Chimienti F., Devergnas S., Pattou F., Schuit F., Garcia-Cuenca R., Vandewalle B., Kerr-Conte J., Van Lommel L., Grunwald D., Favier A., Seve M. J. Cell Sci. 119:4199-4206(2006)
Purity	Greater than 85% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells.
Subcellular Location	Cell membrane, Multi-pass membrane protein, Cytoplasmic vesicle, secretory vesicle membrane, Multi-pass membrane protein
Protein Families	Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Tissue Specificity	In the endocrine pancreas, expressed in insulin-producing beta cells. Expressed at relatively high levels in subcutaneous fat tissue from lean persons; much lower levels in visceral fat, whether from lean or obese individuals, and in subcutaneous fat tissue from obese individuals. Expressed in peripheral blood mononuclear cells, including T-cells and B-cells, with great variation among individuals ranging from negative to strongly positive.
Tag Information	N-terminal 10xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-CF818247HU-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen