ArtNr |
CSB-CF818247HU-100 |
Hersteller |
Cusabio
|
Menge |
100ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
Human |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Research Areas |
Others |
Target / Protein |
SLC30A8 |
Biologically Active |
Not Test |
Expression System |
in vitro E.coli expression system |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
Q8IWU4 |
AA Sequence |
MEFLERTYLVNDKAAKMYAFTLESVELQQKPVNKD QCPRERPEELESGGMYHCHSGSKPTEKGANEYAYA KWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAA HLLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAE ILGALLSILCIWVVTGVLVYLACERLLYPDYQIQA TVMIIVSSCAVAANIVLTVVLHQRCLGHNHKEVQA NASVRAAFVHALGDLFQSISVLISALIIYFKPEYK IADPICTFIFSILVLASTITILKDFSILLMEGVPK SLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVIL SAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQ MESPVDQDPDCLFCEDPCD |
Tag Info |
N-terminal 10xHis-tagged |
Expression Region |
1-369aa |
Protein Length |
Full Length |
MW |
43.6 kDa |
Alternative Name(s) |
Solute carrier family 30 member 8 (ZNT8) |
Relevance |
Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells. |
Reference |
In vivo expression and functional characterization of the zinc transporter ZnT8 in glucose-induced insulin secretion. Chimienti F., Devergnas S., Pattou F., Schuit F., Garcia-Cuenca R., Vandewalle B., Kerr-Conte J., Van Lommel L., Grunwald D., Favier A., Seve M. J. Cell Sci. 119:4199-4206(2006) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells. |
Subcellular Location |
Cell membrane, Multi-pass membrane protein, Cytoplasmic vesicle, secretory vesicle membrane, Multi-pass membrane protein |
Protein Families |
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily |
Tissue Specificity |
In the endocrine pancreas, expressed in insulin-producing beta cells. Expressed at relatively high levels in subcutaneous fat tissue from lean persons; much lower levels in visceral fat, whether from lean or obese individuals, and in subcutaneous fat tissue from obese individuals. Expressed in peripheral blood mononuclear cells, including T-cells and B-cells, with great variation among individuals ranging from negative to strongly positive. |
Tag Information |
N-terminal 10xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.