« Zurück
Home /
Recombinant Human cytomegalovirus Uncharacterized protein UL131(UL131)

Recombinant Human cytomegalovirus Uncharacterized protein UL131(UL131)

ArtNr	CSB-CF323723HWV-10
Hersteller	Cusabio
Menge	10ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Others
Uniprot ID	P16773
Gene Names	UL131
Organism	Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)
AA Sequence	MCMMSHNKAFFLSLQHAAVSGVAVCLSVRRGAGSV PAGNRGKKTIITEYRITGTRALARCPTKPVTSMWN SSWTSR
Expression Region	1-76aa
Sequence Info	Full Length
Source	in vitro E.coli expression system
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	24.2 kDa
Reference	"Analysis of the protein-coding content of the sequence of human cytomegalovirus strain AD169."Chee M.S., Bankier A.T., Beck S., Bohni R., Brown C.M., Cerny R., Horsnell T., Hutchison C.A. III, Kouzarides T., Martignetti J.A., Preddie E., Satchwell S.C., Tomlinson P., Weston K.M., Barrell B.G.Curr. Top. Microbiol. Immunol. 154:125-169(1990)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen