« Zurück
Home /
Recombinant Human Actin-like protein 8(ACTL8)

Recombinant Human Actin-like protein 8(ACTL8)

ArtNr	CSB-BP887982HU-50
Hersteller	Cusabio
Menge	50ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	Q9H568
Gene Names	ACTL8
Organism	Homo sapiens (Human)
AA Sequence	MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNY LPCKENPGPSYARRRVSLGIDICHPDTFSYPIERG RILNWEGVQYLWSFVLENHRREQEVPPVIITETPL REPADRKKMLEILFELLHVPSVLLADQLQMSLYAS GLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEF AGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMN KCYVPQNLGEALDFRERQQSALDESNTYQLPDGSR VELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESV ESCEISLRPLLVSHVMACGGNTLYPGFTKRLFREL MGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTY QSEWMSREEYGEHMRM
Expression Region	1-366aa
Sequence Info	Full Length
Source	Baculovirus
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW	45.4 kDa
Alternative Name(s)	Cancer/testis antigen 57 (CT57)
Reference	"A human interactome in three quantitative dimensions organized by stoichiometries and abundances." Hein M.Y., Hubner N.C., Poser I., Cox J., Nagaraj N., Toyoda Y., Gak I.A., Weisswange I., Mansfeld J., Buchholz F., Hyman A.A., Mann M. Cell 163:712-723(2015)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location	Cytoplasm, cytoskeleton
Protein Families	Actin family
Tissue Specificity	Strongly expressed in testis and pancreas. Weak expression in placenta.
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen