ArtNr |
CSB-BP883621HU-50 |
Hersteller |
Cusabio
|
Menge |
50ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Konjugat/Tag |
Myc |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Research Topic |
Metabolism |
Uniprot ID |
Q9BXJ4 |
Gene Names |
C1QTNF3 |
Organism |
Homo sapiens (Human) |
AA Sequence |
QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPG PPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDL GPRGERGQHGPKGEKGYPGIPPELQIAFMASLATH FSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGV YFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEM KGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQ RFSTFAGFLLFETK |
Expression Region |
23-246aa |
Sequence Info |
Full Length of Mature Protein |
Source |
Baculovirus |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
MW |
28.1 kDa |
Alternative Name(s) |
Collagenous repeat-containing sequence 26 kDa protein (CORS26) (Secretory protein CORS26 ) (CTRP3) |
Reference |
"Effects of the new C1q/TNF-related protein (CTRP-3) "cartonectin" on the adipocytic secretion of adipokines." Wolfing B., Buechler C., Weigert J., Neumeier M., Aslanidis C., Schoelmerich J., Schaffler A. Obesity (Silver Spring) 16:1481-1486(2008) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Subcellular Location |
Secreted |
Tissue Specificity |
Expressed in colon and small intestine. |
Tag Information |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.