« Zurück
Home /
Recombinant Human Complement C1q tumor necrosis factor-related protein 3(C1QTNF3)

Recombinant Human Complement C1q tumor necrosis factor-related protein 3(C1QTNF3)

ArtNr	CSB-BP883621HU-50
Hersteller	Cusabio
Menge	50ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Metabolism
Uniprot ID	Q9BXJ4
Gene Names	C1QTNF3
Organism	Homo sapiens (Human)
AA Sequence	QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPG PPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDL GPRGERGQHGPKGEKGYPGIPPELQIAFMASLATH FSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGV YFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEM KGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQ RFSTFAGFLLFETK
Expression Region	23-246aa
Sequence Info	Full Length of Mature Protein
Source	Baculovirus
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW	28.1 kDa
Alternative Name(s)	Collagenous repeat-containing sequence 26 kDa protein (CORS26) (Secretory protein CORS26 ) (CTRP3)
Reference	"Effects of the new C1q/TNF-related protein (CTRP-3) "cartonectin" on the adipocytic secretion of adipokines." Wolfing B., Buechler C., Weigert J., Neumeier M., Aslanidis C., Schoelmerich J., Schaffler A. Obesity (Silver Spring) 16:1481-1486(2008)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location	Secreted
Tissue Specificity	Expressed in colon and small intestine.
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen