« Zurück
Home /
Recombinant Human E3 ubiquitin-protein ligase pellino homolog 1(PELI1)

Recombinant Human E3 ubiquitin-protein ligase pellino homolog 1(PELI1)

ArtNr	CSB-BP856932HUb0-50
Hersteller	Cusabio
Menge	50ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research areas	Signal Transduction
Target / Protein	PELI1
Biologically active	Not Test
Expression system	Baculovirus
Species of origin	Homo sapiens (Human)
Uniprot ID	Q96FA3
AA Sequence	MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRG RRKSRFALFKRPKANGVKPSTVHIACTPQAAKAIS NKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRS TESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACR IICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKT SDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREIS VCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLID LCGATLLWRTAEGLSHTPTVKHLEALRQEINAARP QCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVH GYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCE AGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLP HGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD
Tag Info	N-terminal 10xHis-tagged
Expression Region	1-418aa
Protein length	Full Length
MW	48.8 kDa
Alternative Name(s)	Pellino-related intracellular-signaling molecule (RING-type E3 ubiquitin transferase pellino homolog 1) (Pellino-1) (PRISM)
Relevance	E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Mediates 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation.
References	"Pellino-1, an adaptor protein of interleukin-1 receptor/toll-like receptor signaling, is sumoylated by Ubc9." Kim J.H., Sung K.S., Jung S.M., Lee Y.S., Kwon J.Y., Choi C.Y., Park S.H. Mol. Cells 31:85-89(2011)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Mediates 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation.
Protein Families	Pellino family
Tag Information	N-terminal 10xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen