ArtNr |
CSB-BP013415HU-50 |
Hersteller |
Cusabio
|
Menge |
50ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
Baculovirus-Infected Insect Cells |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
MAPK/ERK kinase 6,Short name:,MEK 6,Stress-activated protein kinase kinase 3,Short name:,SAPK kinase 3,Short name:,SAPKK-3,Short name:,SAPKK3 |
Lieferbar |
|
Research Topic |
Signal Transduction |
Uniprot ID |
P52564 |
Gene Names |
MAP2K6 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDS KACISIGNQNFEVKADDLEPIMELGRGAYGVVEKM RHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMR TVDCPFTVTFYGALFREGDVWICMELMDTSLDKFY KQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSV IHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAK TIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGI TMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPA DKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFT LHESKGTDVASFVKLILGD |
Expression Region |
1-334aa |
Sequence Info |
Full Length |
Source |
Baculovirus |
Tag Info |
N-terminal 6xHis-tagged |
MW |
39.5 kDa |
Alternative Name(s) |
MAPK/ERK kinase 6 Short name: MEK 6 Stress-activated protein kinase kinase 3 Short name: SAPK kinase 3 Short name: SAPKK-3 Short name: SAPKK3 |
Relevance |
Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. With MAP3K3/MKK3, catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 MAPK11, MAPK12, MAPK13 and MAPK14 and plays an important role in the regulation of cellular responses to cytokines and all kinds of stresses. Especially, MAP2K3/MKK3 and MAP2K6/MKK6 are both essential for the activation of MAPK11 and MAPK13 induced by environmental stress, whereas MAP2K6/MKK6 is the major MAPK11 activator in response to TNF. MAP2K6/MKK6 also phosphorylates and activates PAK6. The p38 MAP kinase signal transduction pathway leads to direct activation of transcription factors. Nuclear targets of p38 MAP kinase include the transcription factors ATF2 and ELK1. Within the p38 MAPK signal transduction pathway, MAP3K6/MKK6 mediates phosphorylation of STAT4 through MAPK14 activation, and is therefore required for STAT4 activation and STAT4-regulated gene expression in response to IL-12 stimulation. The pathway is also crucial for IL-6-induced SOCS3 expression and down-regulation of IL-6-mediated gene induction; and for IFNG-dependent gene transcription. Has a role in osteoclast differentiation through NF-kappa-B transactivation by TNFSF11, and in endochondral ossification and since SOX9 is another likely downstream target of the p38 MAPK pathway. MAP2K6/MKK6 mediates apoptotic cell death in thymocytes. Acts also as a regulator for melanocytes dendricity, through the modulation of Rho family GTPases. |
Reference |
"MKK3- and MKK6-regulated gene expression is mediated by the p38 mitogen-activated protein kinase signal transduction pathway."Raingeaud J., Whitmarsh A.J., Barrett T., Derijard B., Davis R.J.Mol. Cell. Biol. 16:1247-1255(1996) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. With MAP3K3/MKK3, catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 MAPK11, MAPK12, MAPK13 and MAPK14 and plays an important role in the regulation of cellular responses to cytokines and all kinds of stresses. Especially, MAP2K3/MKK3 and MAP2K6/MKK6 are both essential for the activation of MAPK11 and MAPK13 induced by environmental stress, whereas MAP2K6/MKK6 is the major MAPK11 activator in response to TNF. MAP2K6/MKK6 also phosphorylates and activates PAK6. The p38 MAP kinase signal transduction pathway leads to direct activation of transcription factors. Nuclear targets of p38 MAP kinase include the transcription factors ATF2 and ELK1. Within the p38 MAPK signal transduction pathway, MAP3K6/MKK6 mediates phosphorylation of STAT4 through MAPK14 activation, and is therefore required for STAT4 activation and STAT4-regulated gene expression in response to IL-12 stimulation. The pathway is also crucial for IL-6-induced SOCS3 expression and down-regulation of IL-6-mediated gene induction; and for IFNG-dependent gene transcription. Has a role in osteoclast differentiation through NF-kappa-B transactivation by TNFSF11, and in endochondral ossification and since SOX9 is another likely downstream target of the p38 MAPK pathway. MAP2K6/MKK6 mediates apoptotic cell death in thymocytes. Acts also as a regulator for melanocytes dendricity, through the modulation of Rho family GTPases. |
Subcellular Location |
Nucleus, Cytoplasm, Cytoplasm, cytoskeleton |
Protein Families |
Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase subfamily |
Tissue Specificity |
Isoform 2 is only expressed in skeletal muscle. Isoform 1 is expressed in skeletal muscle, heart, and in lesser extent in liver or pancreas. |
Paythway |
MAPKsignalingpathway |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.