« Zurück
Home /
Recombinant Human Glyceraldehyde-3-phosphate dehydrogenase, testis-specific(GAPDHS),partial

Recombinant Human Glyceraldehyde-3-phosphate dehydrogenase, testis-specific(GAPDHS),partial

ArtNr	CSB-BP009254HU-20
Hersteller	Cusabio
Menge	20ug
Kategorie	Oncology Neuroscience Protein Aggregation, Clearance & Misfolding Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Baculovirus-Infected Insect Cells
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2,Short name:GAPDH-2
Lieferbar
Research Areas	Signal Transduction
Uniprot ID	O14556
Gene Names	GAPDHS
Organism	Homo sapiens (Human)
AA Sequence	MVSVARELTVGINGFGRIGRLVLRACMEKGVKVVA VNDPFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQL VVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVY LSIQAASDHISAGAQRVVISAPSPDAPMFVMGVNE NDYNPGSMNIVSNASCTTNCLAPLAKVIHERFGIV EGLMTTVHSYTATQKTVDGPSRKAWRDGRGAHQNI IPASTGAAKAVTKVIPELKGKLTGMAFRVPTPDVS VVDLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAY TEDEVVSTDFLGDTHSSIFDAKAGIALNDNFVKLI SWYDNEYGYSHRVVDLLRYMFSRDK
Expression Region	69-408aa
Sequence Info	Partial
Source	Baculovirus
Tag Info	N-terminal 6xHis-tagged
MW	39.1 kDa
Alternative Name(s)	Spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2 Short name:GAPDH-2
Relevance	May play an important role in regulating the switch between different pathways for energy production during spermiogenesis and in the spermatozoon. Required for sperm motility and male fertility (By similarity).
Reference	Human glyceraldehyde 3-phosphate dehydrogenase-2 gene is expressed specifically in spermatogenic cells.Welch J.E., Brown P.L., O'Brien D.A., Magyar P.L., Bunch D.O., Mori C., Eddy E.M.J. Androl. 21:328-338(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May play an important role in regulating the switch between different pathways for energy production during spermiogenesis and in the spermatozoon. Required for sperm motility and male fertility (By similarity).
Subcellular Location	Cytoplasm
Protein Families	Glyceraldehyde-3-phosphate dehydrogenase family
Tissue Specificity	Testis specific.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-BP009254HU-20-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen