« Zurück
Home /
Recombinant Mouse Thrombospondin-2(Thbs2),partial

Recombinant Mouse Thrombospondin-2(Thbs2),partial

ArtNr	CSB-YP023488MO-200
Hersteller	Cusabio
Menge	200ug
Kategorie	Neuroscience Neuroinflammation Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Others
Uniprot ID	Q03350
Gene Names	Thbs2
Organism	Mus musculus (Mouse)
AA Sequence	GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVP AYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTA QLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDT LDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVAS DTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVA KGASRESHFRGLLQNVHLVFADSVEDILSKKGCQH SQGA
Expression Region	19-232aa
Sequence Info	Partial
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	26.1 kDa
Relevance	Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Ligand for CD36 mediating antiangiogenic properties.
Reference	Characterization of mouse thrombospondin 2 sequence and expression during cell growth and development.Laherty C.D., O'Rourke K., Wolf F.W., Katz R., Seldin M.F., Dixit V.M.J. Biol. Chem. 267:3274-3281(1992)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Ligand for CD36 mediating antiangiogenic properties.
Protein Families	Thrombospondin family
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP023488MO-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen