« Zurück
Home /
Recombinant Mouse Apolipoprotein E(Apoe)

Recombinant Mouse Apolipoprotein E(Apoe)

ArtNr	CSB-YP001936MO-200
Hersteller	Cusabio
Menge	200ug
Kategorie	Neuroscience Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research areas	Others
Target / Protein	Apoe
Biologically active	Not Test
Expression system	Yeast
Species of origin	Mus musculus (Mouse)
Uniprot ID	P08226
AA Sequence	EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTL SDQVQEELQSSQVTQELTALMEDTMTEVKAYKKEL EEQLGPVAEETRARLGKEVQAAQARLGADMEDLRN RLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRL MRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGP LVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRL EEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQ AEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVA TNPIITPVAQENQ
Tag Info	N-terminal 6xHis-tagged
Expression Region	19-311aa
Protein length	Full Length of Mature Protein
MW	36 kDa
Relevance	Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron rnant) of hepatic tissues.
References	Mass spectral analysis of the apolipoproteins on mouse high density lipoproteins. Detection of post-translational modifications.Puppione D.L., Yam L.M., Bassilian S., Souda P., Castellani L.W., Schumaker V.N., Whitelegge J.P.Biochim. Biophys. Acta 1764:1363-1371(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.
Subcellular Location	Secreted
Protein Families	Apolipoprotein A1/A4/E family
Tissue Specificity	Secreted in plasma.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP001936MO-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen