« Zurück
Home /
Recombinant Human Collagen alpha-1(XVIII) chain(COL18A1),partial

Recombinant Human Collagen alpha-1(XVIII) chain(COL18A1),partial

ArtNr	CSB-RP129144h-1
Hersteller	Cusabio
Menge	1mg
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Cell Adhesion
Uniprot ID	P39060
Gene Names	COL18A1
Organism	Homo sapiens (Human)
AA Sequence	QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVG LAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKD ELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRH PTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSAT GQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTA SK
Expression Region	1578-1754aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	46.3 kDa
Relevance	COLA18A probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.Endostatin potently inhibits endothelial cell proliferation and angiogenesis. May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling.
Reference	The DNA sequence of human chromosome 21.Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A. , Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.Nature 405:311-319(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.
Involvement in disease	Knobloch syndrome 1 (KNO1)
Subcellular Location	Secreted, extracellular space, extracellular matrix, Secreted, extracellular space, extracellular matrix, basement membrane, SUBCELLULAR LOCATION: Non-collagenous domain 1: Secreted, extracellular space, extracellular matrix, basement membrane, Secreted, SUBCELLULAR LOCATION: Endostatin: Secreted, Secreted, extracellular space, extracellular matrix, basement membrane
Protein Families	Multiplexin collagen family
Tissue Specificity	Present in multiple organs with highest levels in liver, lung and kidney.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen