ArtNr |
CSB-RP081794h-500 |
Hersteller |
Cusabio
|
Menge |
500ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Receptor expressed in lymphoid tissues |
Lieferbar |
|
Research Topic |
Signal Transduction |
Uniprot ID |
Q969Z4 |
Gene Names |
RELT |
Organism |
Homo sapiens (Human) |
AA Sequence |
STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAW GSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWP GWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARR GVEVAAGASSGGETRQPGNGTRA |
Expression Region |
26-153aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
17.7 kDa |
Alternative Name(s) |
Receptor expressed in lymphoid tissues |
Relevance |
Mediates activation of NF-kappa-B. May play a role in T-cell activation. |
Reference |
RELT, a new member of the tumor necrosis factor receptor superfamily, is selectively expressed in hematopoietic tissues and activates transcription factor NF-kappaB.Sica G.L., Zhu G., Tamada K., Liu D., Ni J., Chen L.Blood 97:2702-2707(2001) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Mediates activation of NF-kappa-B. May play a role in T-cell activation. |
Subcellular Location |
Cell membrane, Single-pass type I membrane protein, Cytoplasm |
Protein Families |
RELT family |
Tissue Specificity |
Highest levels are in spleen, lymph node, thymus, peripheral blood leukocytes, bone marrow and fetal liver. Very low levels in skeletal muscle, testis and colon. Not detected in brain, kidney and pancreas. |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.