ArtNr |
CSB-RP059654h-200 |
Hersteller |
Cusabio
|
Menge |
200ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Host |
E.coli |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Monocyte chemoattractant protein 3Monocyte chemotactic protein 3 ;MCP-3NC28Small-inducible cytokine A7 |
Lieferbar |
|
Research Topic |
Immunology |
Uniprot ID |
P80098 |
Gene Names |
CCL7 |
Organism |
Homo sapiens (Human) |
AA Sequence |
QPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSH CPREAVIFKTKLDKEICADPTQKWVQDFMKHLDKK TQTPKL |
Expression Region |
24-99aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
36 kDa |
Alternative Name(s) |
Monocyte chemoattractant protein 3Monocyte chemotactic protein 3 ; MCP-3NC28Small-inducible cytokine A7 |
Relevance |
Chotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. Binds to CCR1, CCR2 and CCR3. |
Reference |
Determination of the three-dimensional structure of CC chemokine monocyte chemoattractant protein 3 by 1H two-dimensional NMR spectroscopy.Meunier S., Bernassau J.-M., Guillemot J.-C., Ferrara P., Darbon H.Biochemistry 36:4412-4422(1997) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. Binds to CCR1, CCR2 and CCR3. |
Subcellular Location |
Secreted |
Protein Families |
Intercrine beta (chemokine CC) family |
Paythway |
Chemokinesignalingpathway |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.