Vergleich

Recombinant Human Cytochrome b-c1 complex subunit 10 protein(UQCR11)

Hersteller Cusabio
Kategorie
Typ Proteins Recombinant
Specific against other
Format Liquid or Lyophilized powder
Menge 50ug
Host E.coli
ArtNr CSB-RP037854h-50
Konjugat/Tag GST
eClass 6.1 34160400
eClass 9.0 42020190
Lieferbar
Alias Complex III subunit 10Complex III subunit XIUbiquinol-cytochrome c reductase complex 6.4KDA protein
Purity Greater than 90% as determined by SDS-PAGE.
Research Topic
Transport
Uniprot ID
O14957
Gene Names
UQCR11
Organism
Homo sapiens (Human)
AA Sequence
MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWA TDWRLILDWVPYINGKFKKDN
Expression Region
1-56aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
33.6 kDa
Alternative Name(s)
Complex III subunit 10Complex III subunit XIUbiquinol-cytochrome c reductase complex 6.4KDA protein
Relevance
This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain.This protein may be closely linked to the iron-sulfur protein in the complex and function as an iron-sulfur protein binding factor.
Reference
The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain.; FUNCTION
Subcellular Location
Mitochondrion inner membrane
Protein Families
UQCR11/QCR10 family
Paythway
Cardiacmusclecontraction
Tag Information
N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen