ArtNr |
CSB-RP031054h-1 |
Hersteller |
Cusabio
|
Menge |
1mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Host |
E.coli |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Deubiquitinating enzyme eIF3f (EC:3.4.19.12) |
Lieferbar |
|
Research Areas |
Metabolism |
Uniprot ID |
O00303 |
Gene Names |
EIF3F |
Organism |
Homo sapiens (Human) |
AA Sequence |
MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAA APVPAAAPASSSDPAAAAAATAAPGQTPASAQAPA QTPAPALPGPALPGPFPGGRVVRLHPVILASIVDS YERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHN ESEDEVAVDMEFAKNMYELHKKVSPNELILGWYAT GHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGR MSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTE RIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQ DALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQV PKIVPDDF |
Expression Region |
1-323aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
60.7 kDa |
Alternative Name(s) |
Deubiquitinating enzyme eIF3f (EC:3.4.19.12) |
Relevance |
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassbly and recycling of post-termination ribosomal complexes and subsequently prevents prature joining of the 40S and 60S ribosomal subunits prior to initiation. |
Reference |
Structure of cDNAs encoding human eukaryotic initiation factor 3 subunits. Possible roles in RNA binding and macromolecular assembly.Asano K., Vornlocher H.-P., Richter-Cook N.J., Merrick W.C., Hinnebusch A.G., Hershey J.W.B.J. Biol. Chem. 272:27042-27052(1997) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis |
Subcellular Location |
Cytoplasm |
Protein Families |
EIF-3 subunit F family |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.