« Zurück
Home /
Recombinant Human Rhombotin-1(LMO1),partial

Recombinant Human Rhombotin-1(LMO1),partial

ArtNr	CSB-RP020544h-50
Hersteller	Cusabio
Menge	50ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cysteine-rich protein TTG-1LIM domain only protein 1 ;LMO-1T-cell translocation protein 1
Lieferbar
Research Topic	Epigenetics and Nuclear Signaling
Uniprot ID	P25800
Gene Names	LMO1
Organism	Homo sapiens (Human)
AA Sequence	DKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKA LDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILC RRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVY HLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEE GQLNGTFESQVQ
Expression Region	5-156aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	44.4 kDa
Alternative Name(s)	Cysteine-rich protein TTG-1LIM domain only protein 1 ; LMO-1T-cell translocation protein 1
Relevance	May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.
Reference	Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.
Involvement in disease	A chromosomal aberration involving LMO1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11, 14)(p15; q11) with TCRD.
Subcellular Location	Nucleus
Tissue Specificity	Expressed mainly in the central nervous. Low level of expression in other tissues including thymus.
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen