ArtNr |
CSB-RP006544h-1 |
Hersteller |
Cusabio
|
Menge |
1mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Konjugat/Tag |
GST |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
40S ribosomal protein S19-binding protein 1,Short name:,RPS19-binding protein 1,Short name:,S19BP |
Lieferbar |
|
Research Areas |
Cell Biology |
Uniprot ID |
Q86WX3 |
Gene Names |
AROS |
Organism |
Homo sapiens (Human) |
AA Sequence |
MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKR PRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRD HLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACD RPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS |
Expression Region |
1-145aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
42.4 kDa |
Alternative Name(s) |
40S ribosomal protein S19-binding protein 1 Short name: RPS19-binding protein 1 Short name: S19BP |
Relevance |
Direct regulator of SIRT1. Enhances SIRT1-mediated deacetylation of p53/TP53, thereby participating in inhibition of p53/TP53-mediated transcriptional activity. |
Reference |
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). The MGC Project Team Genome Res. 14:2121-2127(2004) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Tag Information |
N-terminal GST-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.