« Zurück
Home /
Recombinant Human V-type proton ATPase subunit G 1(ATP6V1G1)

Recombinant Human V-type proton ATPase subunit G 1(ATP6V1G1)

ArtNr	CSB-RP001344h-200
Hersteller	Cusabio
Menge	200ug
Quantity options	1mg 10ug 100ug 200ug 50ug 500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	V-ATPase 13KDA subunit 1Vacuolar proton pump subunit G 1Vacuolar proton pump subunit M16
Lieferbar
Research Topic	Transport
Uniprot ID	O75348
Gene Names	ATP6V1G1
Organism	Homo sapiens (Human)
AA Sequence	ASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQA KEEAQAEIEQYRLQREKEFKAKEAAALGSRGSCST EVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDI RPEIHENYRING
Expression Region	2-118aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	40.6 kDa
Alternative Name(s)	V-ATPase 13KDA subunit 1Vacuolar proton pump subunit G 1Vacuolar proton pump subunit M16
Relevance	Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Reference	"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation
Protein Families	V-ATPase G subunit family
Tissue Specificity	Ubiquitous.
Paythway	mTORsignalingpathway

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen