ArtNr |
CSB-EP874822HU-200 |
Hersteller |
Cusabio
|
Menge |
200ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Putative GTP-binding protein RAY-likeRab-like protein 4 |
Lieferbar |
|
Research Topic |
Signal Transduction |
Uniprot ID |
Q9BW83 |
Gene Names |
IFT27 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKS YTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKEL FSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLE KARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARA WALGQGLECFETSVKEMENFEAPFHCLAKQFHQLY REKVEVFRALA |
Expression Region |
1-186aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
36.5 kDa |
Alternative Name(s) |
Putative GTP-binding protein RAY-likeRab-like protein 4 |
Relevance |
Small GTPase-like component of the intraflagellar transport (IFT) complex B that promotes the exit of the BBSome complex from cilia via its interaction with ARL6 . Not involved in entry of the BBSome complex into cilium. Prevents aggregation of GTP-free ARL6 . Required for hedgehog signaling. Forms a subcomplex within the IFT complex B with IFT25 . |
Reference |
Reevaluating human gene annotation a second-generation analysis of chromosome 22.Collins J.E., Goward M.E., Cole C.G., Smink L.J., Huckle E.J., Knowles S., Bye J.M., Beare D.M., Dunham I.Genome Res. 13:27-36(2003) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Small GTPase-like component of the intraflagellar transport (IFT) complex B that promotes the exit of the BBSome complex from cilia via its interaction with ARL6 |
Involvement in disease |
Bardet-Biedl syndrome 19 (BBS19) |
Subcellular Location |
Cell projection, cilium |
Protein Families |
Small GTPase superfamily, Rab family |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.