« Zurück
Home /
Recombinant Human Intraflagellar transport protein 27 homolog(IFT27)

Recombinant Human Intraflagellar transport protein 27 homolog(IFT27)

ArtNr	CSB-EP874822HU-200
Hersteller	Cusabio
Menge	200ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Putative GTP-binding protein RAY-likeRab-like protein 4
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	Q9BW83
Gene Names	IFT27
Organism	Homo sapiens (Human)
AA Sequence	MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKS YTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKEL FSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLE KARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARA WALGQGLECFETSVKEMENFEAPFHCLAKQFHQLY REKVEVFRALA
Expression Region	1-186aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	36.5 kDa
Alternative Name(s)	Putative GTP-binding protein RAY-likeRab-like protein 4
Relevance	Small GTPase-like component of the intraflagellar transport (IFT) complex B that promotes the exit of the BBSome complex from cilia via its interaction with ARL6 . Not involved in entry of the BBSome complex into cilium. Prevents aggregation of GTP-free ARL6 . Required for hedgehog signaling. Forms a subcomplex within the IFT complex B with IFT25 .
Reference	Reevaluating human gene annotation a second-generation analysis of chromosome 22.Collins J.E., Goward M.E., Cole C.G., Smink L.J., Huckle E.J., Knowles S., Bye J.M., Beare D.M., Dunham I.Genome Res. 13:27-36(2003)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Small GTPase-like component of the intraflagellar transport (IFT) complex B that promotes the exit of the BBSome complex from cilia via its interaction with ARL6
Involvement in disease	Bardet-Biedl syndrome 19 (BBS19)
Subcellular Location	Cell projection, cilium
Protein Families	Small GTPase superfamily, Rab family
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP874822HU-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen