ArtNr |
CSB-EP624036HU-200 |
Hersteller |
Cusabio
|
Menge |
200ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Liver kinase B1 ;LKB1 ;hLKB1Renal carcinoma antigen NY-REN-19 |
Lieferbar |
|
Research Topic |
Apoptosis |
Uniprot ID |
Q15831 |
Gene Names |
STK11 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVI YQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSE TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRL RHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEML DSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHK DIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTC RTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTL YNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGP PLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPP AEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADED EDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRG LPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSA SSKIRRLSAC |
Expression Region |
1-430aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
64.3 kDa |
Alternative Name(s) |
Liver kinase B1 ; LKB1 ; hLKB1Renal carcinoma antigen NY-REN-19 |
Relevance |
Tumor suppressor serine/threonine-protein kinase that controls the activity of AMP-activated protein kinase (AMPK) family mbers, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. Acts by phosphorylating the T-loop of AMPK family proteins, thus promoting their activity: phosphorylates PRKAA1, PRKAA2, BRSK1, BRSK2, MARK1, MARK2, MARK3, MARK4, NUAK1, NUAK2, SIK1, SIK2, SIK3 and SNRK but not MELK. Also phosphorylates non-AMPK family proteins such as STRADA, PTEN and possibly p53/TP53. Acts as a key upstream regulator of AMPK by mediating phosphorylation and activation of AMPK catalytic subunits PRKAA1 and PRKAA2 and thereby regulates processes including: inhibition of signaling pathways that promote cell growth and proliferation when energy levels are low, glucose homeostasis in liver, activation of autophagy when cells undergo nutrient deprivation, and B-cell differentiation in the germinal center in response to DNA damage. Also acts as a regulator of cellular polarity by rodeling the actin cytoskeleton. Required for cortical neuron polarization by mediating phosphorylation and activation of BRSK1 and BRSK2, leading to axon initiation and specification. Involved in DNA damage response: interacts with p53/TP53 and recruited to the CDKN1A/WAF1 promoter to participate in transcription activation. Able to phosphorylate p53/TP53; the relevance of such result in vivo is however unclear and phosphorylation may be indirect and mediated by downstream STK11/LKB1 kinase NUAK1. Also acts as a mediator of p53/TP53-dependent apoptosis via interaction with p53/TP53: translocates to the mitochondrion during apoptosis and regulates p53/TP53-dependent apoptosis pathways. In vein endothelial cells, inhibits PI3K/Akt signaling activity and thus induces apoptosis in response to the oxidant peroxynitrite (in vitro). Regulates UV radiation-induced DNA damage response mediated by CDKN1A. In association with NUAK1, phosphorylates CDKN1A in response to UV radiation and contributes to its degradation which is necessary for optimal DNA repair |
Reference |
Peutz-Jeghers syndrome is caused by mutations in a novel serine threonine kinase.Jenne D.E., Reimann H., Nezu J., Friedl W., Loff S., Jeschke R., Mueller O., Back W., Zimmer M.Nat. Genet. 18:38-43(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Tumor suppressor serine/threonine-protein kinase that controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. Acts by phosphorylating the T-loop of AMPK family proteins, thus promoting their activity |
Involvement in disease |
Peutz-Jeghers syndrome (PJS); Testicular germ cell tumor (TGCT) |
Subcellular Location |
Nucleus, Cytoplasm, Membrane, Mitochondrion, Note=A small fraction localizes at membranes (By similarity), Relocates to the cytoplasm when bound to STRAD (STRADA or STRADB) and CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta), Translocates to the mitochondrion during apoptosis, Translocates to the cytoplasm in response to metformin or peroxynitrite treatment, PTEN promotes cytoplasmic localization, SUBCELLULAR LOCATION: Isoform 2: Nucleus, Cytoplasm |
Protein Families |
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, LKB1 subfamily |
Tissue Specificity |
Ubiquitously expressed. Strongest expression in testis and fetal liver. |
Paythway |
mTORsignalingpathway |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.