ArtNr |
CSB-EP613691HU(F)-500 |
Hersteller |
Cusabio
|
Menge |
500ug |
Quantity options |
1mg
10ug
100ug
20ug
200ug
50ug
500ug
|
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Chemokine CC-1/CC-3 ;HCC-1/HCC-3HCC-1(1-74)NCC-2Small-inducible cytokine A14 |
Lieferbar |
|
Research Topic |
Immunology |
Uniprot ID |
Q16627 |
Gene Names |
CCL14 |
Organism |
Homo sapiens (Human) |
AA Sequence |
TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYE TNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKD MKEN |
Expression Region |
20-93aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
24.7 kDa |
Alternative Name(s) |
Chemokine CC-1/CC-3 ; HCC-1/HCC-3HCC-1(1-74)NCC-2Small-inducible cytokine A14 |
Relevance |
Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induced intracellular Ca2+ changes and enzyme release, but no chotaxis, at concentrations of 100-1, 000 nM, and was inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1(9-74) is a chotactic factor that attracts monocytes eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5. |
Reference |
HCC-1, a novel chemokine from human plasma.Schulz-Knappe P., Maegert H.-J., Dewald B., Meyer M., Cetin Y., Kubbies M., Tomeczkowski J., Kirchhoff K., Raida M., Adermann K., Kist A., Reinecke M., Sillard R., Pardigol A., Uguccioni M., Baggiolini M., Forssmann W.-G.J. Exp. Med. 183:295-299(1996) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induced intracellular Ca(2+) changes and enzyme release, but no chemotaxis, at concentrations of 100-1, 000 nM, and was inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1(9-74) is a chemotactic factor that attracts monocytes eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5. |
Subcellular Location |
Secreted |
Protein Families |
Intercrine beta (chemokine CC) family |
Tissue Specificity |
Expressed constitutively in several normal tissues: spleen, liver, skeletal and heart muscle, gut, and bone marrow, present at high concentrations (1-80 nM) in plasma. |
Paythway |
Chemokinesignalingpathway |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.