« Zurück
Home /
Recombinant Human Tumor necrosis factor receptor superfamily member 1B(TNFRSF1B),partial

Recombinant Human Tumor necrosis factor receptor superfamily member 1B(TNFRSF1B),partial

ArtNr	CSB-EP023978HU-1
Hersteller	Cusabio
Menge	1mg
Kategorie	Neuroscience Metabolism Diabetes Glucose Homeostasis Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Tumor necrosis factor receptor 2 ;TNF-R2Tumor necrosis factor receptor type II ;TNF-RII ;TNFR-IIp75p80 TNF-alpha receptor; CD120bINN: Etanercept
Lieferbar
Alternative Name(s)	Tumor necrosis factor receptor 2 ; TNF-R2Tumor necrosis factor receptor type II ; TNF-RII ; TNFR-IIp75p80 TNF-alpha receptor; CD120bINN: Etanercept
AA Sequence	VAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQ HAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSC GSRCSSDQVETQACTREQNRICTCRPGWYCALSKQ EGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAP GTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCT ST
Research Topic	Cell Biology
Uniprot ID	P20333
Gene Names	TNFRSF1B
Tag Info	N-terminal GST-tagged
Expression Region	27-203aa
MW of Fusion Proten	46, 3
Sequence Info	Partial
Relevance	Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.
Reference	A second tumor necrosis factor receptor gene product can shed a naturally occurring tumor necrosis factor inhibitor.Kohno T., Brewer M.T., Baker S.L., Schwartz P.E., King M.W., Hale K.K., Squires C.H., Thompson R.C., Vannice J.L.Proc. Natl. Acad. Sci. U.S.A. 87:8331-8335(1990)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Homo sapiens (Human)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen