« Zurück
Home /
Recombinant Human UV excision repair protein RAD23 homolog A(RAD23A)

Recombinant Human UV excision repair protein RAD23 homolog A(RAD23A)

ArtNr	CSB-EP019259HU-500
Hersteller	Cusabio
Menge	500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research areas	Epigenetics and Nuclear Signaling
Target / Protein	RAD23A
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P54725
AA Sequence	MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAE KGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKN FVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFPP APTSGMSHPPPAAREDKSPSEESAPTTSPESVSGS VPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGY ERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEH GSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMR QVIQQNPALLPALLQQLGQENPQLLQQISRHQEQF IQMLNEPPGELADISDVEGEVGAIGEEAPQMNYIQ VTPQEKEAIERLKALGFPESLVIQAYFACEKNENL AANFLLSQNFDDE
Tag Info	N-terminal GST-tagged
Expression Region	1-363aa
Protein length	Full Length
MW	66.6 kDa
Relevance	Multiubiquitin chain receptor involved in modulation of proteasomal degradation. Binds to 'Lys-48'-linked polyubiquitin chains in a length-dependent manner and with a lower affinity to 'Lys-63'-linked polyubiquitin chains. Proposed to be capable to bind simultaneously to the 26S proteasome and to polyubiquitinated substrates and to deliver ubiquitinated proteins to the proteasome.Involved in nucleotide excision repair and is thought to be functional equivalent for RAD23B in global genome nucleotide excision repair (GG-NER) by association with XPC. In vitro, the XPC:RAD23A dimer has NER activity. Can stabilize XPC.Involved in vpr-dependent replication of HIV-1 in non-proliferating cells and primary macrophages. Required for the association of HIV-1 vpr with the host proteasome.
References	Components of the ubiquitin-proteasome pathway compete for surfaces on Rad23 family proteins.Goh A.M., Walters K.J., Elsasser S., Verma R., Deshaies R.J., Finley D., Howley P.M.BMC Biochem. 9:4-4(2008)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Multiubiquitin chain receptor involved in modulation of proteasomal degradation. Binds to 'Lys-48'-linked polyubiquitin chains in a length-dependent manner and with a lower affinity to 'Lys-63'-linked polyubiquitin chains. Proposed to be capable to bind simultaneously to the 26S proteasome and to polyubiquitinated substrates and to deliver ubiquitinated proteins to the proteasome.; FUNCTION
Subcellular Location	Nucleus
Protein Families	RAD23 family
Paythway	Proteinprocessinginendoplasmicreticulum
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen